PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00044067001
Common NameGSBRNA2T00044067001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LFY
Protein Properties Length: 403aa    MW: 44771.1 Da    PI: 6.3951
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00044067001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY560.93.9e-17113791386
              FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlm 90 
                          mdpe f++ lf+w+p  a++++p+ + + ++++++p++ ++aa  ++l +le lf  yGvr++t+akiaelGft+stLv+mkdeel+d+m
  GSBRNA2T00044067001   1 MDPEGFTSGLFRWNPTRAMVQAPTAIPPPQQQQQSPATPQTAAFGMRLGGLEGLFGPYGVRFYTAAKIAELGFTASTLVGMKDEELEDMM 90 
                          9*************98888888889999999999998888888888899***************************************** PP

              FLO_LFY  91 kslseifrldllvGeryGikaavraerrrleeeeaekkrrkll...sedeet..aldalsqe....glseepvqeekeaagsggeglgea 171
                          +sls+ifr++llvGery              eee++++rr+ll   + d+ t  aldalsqe    glseepvq++ ++ ++g +  g+ 
  GSBRNA2T00044067001  91 NSLSHIFRWELLVGERYE-------------EEEESSRRRHLLlsaAGDSGThlALDALSQEddwtGLSEEPVQHQDHTDAAGINCGGRG 167
                          ****************93.............334455666655577445544469******988889******99766555544443444 PP

              FLO_LFY 172 elvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeeg...sgedgeerqrehPfivtepgevargkknGLDYLfdLyeq 258
                          +   a ++   + kk++ + ++++k   + + e+d+d +e ed+d+++   ++ +g+erqrehPfivtepgevargkknGLDYLf+Lyeq
  GSBRNA2T00044067001 168 GHWEAGQT---TIKKQQ-Q-RRRKKAIVT-SVETDDDGNEGEDDDGMDivnGSGSGMERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQ 251
                          44443322...222222.2.233333333.334445544444444444443667799********************************* PP

              FLO_LFY 259 CrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaia 348
                          CrefLlqvq+iak+rGekcPtkvtnqvfryakk+ga+yinkPkmrhYvhCYalhcLdeeasnalrr+fkergenvG+wrqacykplv+ia
  GSBRNA2T00044067001 252 CREFLLQVQTIAKDRGEKCPTKVTNQVFRYAKKSGANYINKPKMRHYVHCYALHCLDEEASNALRRTFKERGENVGSWRQACYKPLVDIA 341
                          ****************************************************************************************** PP

              FLO_LFY 349 arqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                           r+gwdidavfnahprLsiWYvPtkLrqLChler++a+
  GSBRNA2T00044067001 342 CRHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNNAV 379
                          **********************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.8E-1811378IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRAMV QAPTAIPPPQ QQQQSPATPQ TAAFGMRLGG LEGLFGPYGV  60
RFYTAAKIAE LGFTASTLVG MKDEELEDMM NSLSHIFRWE LLVGERYEEE EESSRRRHLL  120
LSAAGDSGTH LALDALSQED DWTGLSEEPV QHQDHTDAAG INCGGRGGHW EAGQTTIKKQ  180
QQRRRKKAIV TSVETDDDGN EGEDDDGMDI VNGSGSGMER QREHPFIVTE PGEVARGKKN  240
GLDYLFHLYE QCREFLLQVQ TIAKDRGEKC PTKVTNQVFR YAKKSGANYI NKPKMRHYVH  300
CYALHCLDEE ASNALRRTFK ERGENVGSWR QACYKPLVDI ACRHGWDIDA VFNAHPRLSI  360
WYVPTKLRQL CHLERNNAVA AAAALVGGIS CEGSSASGRF GV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy2_A1e-1272174022187PROTEIN LEAFY
2vy1_A1e-1272174022187PROTEIN LEAFY
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8177990.0KR817799.1 Brassica juncea cultivar Varuna LEAFY (LFY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009150114.10.0PREDICTED: putative transcription factor BOFH isoform X1
SwissprotQ055360.0BOFH_BRAOB; Putative transcription factor BOFH
TrEMBLA0A078JEC90.0A0A078JEC9_BRANA; BnaA06g39070D protein
STRINGBra019619.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]